PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g052900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 275aa    MW: 30206 Da    PI: 8.388
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g052900.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-18111165256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq + Lee F+ +++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Csa07g052900.1 111 RKKLRLTKEQSDLLEESFKHHSTLNPKQKQVLARELNLRPRQVEVWFQNRRARTK 165
                     788899***********************************************98 PP

2HD-ZIP_I/II123.78.8e-40111200191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+keq+ lLEesF+++++L+p++K+ lareL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en rL+ke +eL+ +l
  Csa07g052900.1 111 RKKLRLTKEQSDLLEESFKHHSTLNPKQKQVLARELNLRPRQVEVWFQNRRARTKLKQTEVDCEVLKKCCETLTDENMRLRKEIQELK-TL 200
                     69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.151107167IPR001356Homeobox domain
SMARTSM003894.9E-16109171IPR001356Homeobox domain
SuperFamilySSF466893.38E-18109175IPR009057Homeodomain-like
CDDcd000861.49E-16111168No hitNo description
Gene3DG3DSA:1.10.10.602.3E-17111165IPR009057Homeodomain-like
PfamPF000468.9E-16111165IPR001356Homeobox domain
PROSITE patternPS000270142165IPR017970Homeobox, conserved site
SMARTSM003408.5E-22167210IPR003106Leucine zipper, homeobox-associated
PfamPF021835.9E-10167200IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MSFDDSCNSG LVLGLGLSPT PNNYNNAIKR STGYKLEPSL TLSLSGDPLL TVVAGADQLC  60
RQTSSLSGVS SFSSGRVVKR ERYSGEESPE EEETTERVVS DYREDEGVSA RKKLRLTKEQ  120
SDLLEESFKH HSTLNPKQKQ VLARELNLRP RQVEVWFQNR RARTKLKQTE VDCEVLKKCC  180
ETLTDENMRL RKEIQELKTL KLSNQPVYMH MPASTLTMCS SCERIGAGGG RNGGGSGGSM  240
ATTVVVDGDR AKGAFSISSK PHFFNPYTNP SAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159167RRARTKLKQ
2228234GGRNGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2292180.0AK229218.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL16-50-N10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417040.10.0PREDICTED: homeobox-leucine zipper protein HAT9-like
SwissprotP466031e-142HAT9_ARATH; Homeobox-leucine zipper protein HAT9
TrEMBLD7LE401e-156D7LE40_ARALL; Homeobox-leucine zipper protein 9
STRINGfgenesh2_kg.4__202__AT2G22800.11e-156(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22800.11e-137HD-ZIP family protein